PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen01g048260.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 215aa    MW: 24549.2 Da    PI: 9.8868
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen01g048260.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.11.7e-26959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      k+i+n + rqvtfskRr g++KKA+ELS+LCda++ +i+fs tgkl+eyss
  Sopen01g048260.1  9 KKIDNLTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSS 59
                      68***********************************************96 PP

2K-box44.18.8e-1684174999
             K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                       l++++  s ++ +a L +   +  re+R+l Ge+L+ L l eL++Le+ +e +++++ + K + ++++i+ l+kke +lqeen +L+k+ +
  Sopen01g048260.1  84 LHSSNLLSEKKTHAMLSRDFVEKNRELRQLHGEELQGLGLDELMKLEKLVEGGISRVLKIKGDKFMKEISSLKKKEAKLQEENSQLKKQSQ 174
                       66777777777788888888777899*************************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.777161IPR002100Transcription factor, MADS-box
SMARTSM004327.7E-39160IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002651.15E-36376No hitNo description
PRINTSPR004044.6E-26323IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.26E-29383IPR002100Transcription factor, MADS-box
PfamPF003192.6E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129711.84289179IPR002487Transcription factor, K-box
PfamPF014862.0E-1393172IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MVRQKIQIKK IDNLTARQVT FSKRRRGLFK KAQELSTLCD ADIGLIVFSA TGKLFEYSSS  60
SMMQLIEKHK MQSERDSMDN PEQLHSSNLL SEKKTHAMLS RDFVEKNREL RQLHGEELQG  120
LGLDELMKLE KLVEGGISRV LKIKGDKFMK EISSLKKKEA KLQEENSQLK KQSQARLNEE  180
VQNVIEQGHS ADSVTNNRSL VNDSDTSLKL CLAFP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S2e-17174174Myocyte-specific enhancer factor 2B
1tqe_R2e-17174174Myocyte-specific enhancer factor 2B
1tqe_Q2e-17174174Myocyte-specific enhancer factor 2B
1tqe_P2e-17174174Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0086520.0AF008652.1 Solanum tuberosum MADS transcriptional factor (Stmads11) mRNA, complete cds.
GenBankAY6437250.0AY643725.1 Solanum tuberosum MADS11 (MADS11) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015068707.11e-155PREDICTED: MADS-box protein SVP-like
SwissprotQ9FVC11e-64SVP_ARATH; MADS-box protein SVP
TrEMBLK4B2F01e-150K4B2F0_SOLLC; Uncharacterized protein
STRINGSolyc01g105800.2.11e-150(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9382377
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.11e-53MIKC_MADS family protein